Company Intelligence
pellysfishmarketandcafe.com
Observed evidence about this site. Every fact below carries where it came from and when it was last confirmed.
Machine-readable: this record as JSON
- Last observed
- Sep 4, 2026, 10:36 AM UTCFresh
- Record last changed
- Sep 4, 2026, 10:36 AM UTC
- Observations
- 91
- Sources read
- 14 of 14
Re-observing without a change does not move this.
Observed intelligence
Identity
- Published namenull
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- https://pellysfishmarketandcafe.com → declared og:site_name
- First observed
- Sep 4, 2026, 10:36 AM UTC
- Published descriptionIn our café, we use the same quality fish that we sell in the market. It is cut daily and used on our ‘killer’ sandwiches, tacos, and grilled seafood plates. The clam chowder — Boston (white) and Manhattan (red) — is made daily 7 days a week. Remember to save room for Pelly’s homemade key lime pie!
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- https://pellysfishmarketandcafe.com
- First observed
- Sep 4, 2026, 10:36 AM UTC
- Declared languageen
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- https://pellysfishmarketandcafe.com
- First observed
- Sep 4, 2026, 10:36 AM UTC
- Canonical URLhttps://pellysfishmarketandcafe.com/
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- https://pellysfishmarketandcafe.com
- First observed
- Sep 4, 2026, 10:36 AM UTC
- Logohttps://static.spotapps.co/website_images/ab_websites/208915_website_v1/logo_new_1.png
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- https://pellysfishmarketandcafe.com → image inside the header's link to the site root
- First observed
- Sep 4, 2026, 10:36 AM UTC
- Site iconhttps://static.spotapps.co/website_images/ab_websites/208915_website_v1/favicons/apple-touch-icon.png
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- https://pellysfishmarketandcafe.com
Hiring
Nothing observed in this category.
External identities
- Facebook page115901741763034
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- publisher_link: https://www.facebook.com/115901741763034
- First observed
- Sep 4, 2026, 10:36 AM UTC
- Instagram accountpellysfishmarket
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- publisher_link: https://www.instagram.com/pellysfishmarket
- First observed
- Sep 4, 2026, 10:36 AM UTC
Contact
- pellysseafoodmarketandcafe@gmail.compellysseafoodmarketandcafe@gmail.com
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- https://pellysfishmarketandcafe.com → address on another registrable domain — referenced, not the subject's contact point
- First observed
- Sep 4, 2026, 10:36 AM UTC
- +17604318454@type: ContactPoint · telephone: +17604318454
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- https://pellysfishmarketandcafe.com
- First observed
- Sep 4, 2026, 10:36 AM UTC
People
Nothing observed in this category.
Outbound links
- static.spotapps.co21 distinct paths linked
Derived from observations · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- 21 link observation(s)
- First observed
- Sep 4, 2026, 10:36 AM UTC
- google.comGoogle page
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- 2 link observation(s)
- First observed
- Sep 4, 2026, 10:36 AM UTC
- google.comGet Directions
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- 1 link observation(s)
- First observed
- Sep 4, 2026, 10:36 AM UTC
- spothopperapp.comSpotHopper logo
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- 1 link observation(s)
- First observed
- Sep 4, 2026, 10:36 AM UTC
- spothopperapp.comWebsite design, Social Media marketing and Email marketing provided by SpotHopper.
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- 1 link observation(s)
- First observed
- Sep 4, 2026, 10:36 AM UTC
- tmt.spotapps.coJob Listings
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- 2 link observation(s)
- First observed
- Sep 4, 2026, 10:36 AM UTC
- yelp.comYelp page
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- 1 link observation(s)
- First observed
- Sep 4, 2026, 10:36 AM UTC
- yelp.comYelp reviews
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- 1 link observation(s)
- First observed
- Sep 4, 2026, 10:36 AM UTC
- doordash.comOrder from DoorDash
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- 1 link observation(s)
- First observed
- Sep 4, 2026, 10:36 AM UTC
- ubereats.comOrder from Uber Eats
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- 1 link observation(s)
- First observed
- Sep 4, 2026, 10:36 AM UTC
Locations
Nothing observed in this category.
Content
- URLs declared in sitemaps8
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- sitemap.xml
- First observed
- Sep 4, 2026, 10:36 AM UTC
- Homepagehttps://pellysfishmarketandcafe.com/
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- First observed
- Sep 4, 2026, 10:36 AM UTC
- URLhttps://pellysfishmarketandcafe.com/accessibility-page-01
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- First observed
- Sep 4, 2026, 10:36 AM UTC
- URLhttps://pellysfishmarketandcafe.com/carlsbad-pelly-s-fish-market-and-cafe-about
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- First observed
- Sep 4, 2026, 10:36 AM UTC
- URLhttps://pellysfishmarketandcafe.com/carlsbad-pelly-s-fish-market-and-cafe-cater
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- First observed
- Sep 4, 2026, 10:36 AM UTC
- URLhttps://pellysfishmarketandcafe.com/carlsbad-pelly-s-fish-market-and-cafe-drink-menu
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- First observed
- Sep 4, 2026, 10:36 AM UTC
- URLhttps://pellysfishmarketandcafe.com/carlsbad-pelly-s-fish-market-and-cafe-events
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- First observed
- Sep 4, 2026, 10:36 AM UTC
- URLhttps://pellysfishmarketandcafe.com/carlsbad-pelly-s-fish-market-and-cafe-fish-market
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- First observed
- Sep 4, 2026, 10:36 AM UTC
- URLhttps://pellysfishmarketandcafe.com/carlsbad-pelly-s-fish-market-and-cafe-food-menu
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- First observed
- Sep 4, 2026, 10:36 AM UTC
- URLhttps://order.pellysfishmarketandcafe.com/
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- First observed
- Sep 4, 2026, 10:36 AM UTC
- URLhttps://pay.pellysfishmarketandcafe.com/
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- First observed
- Sep 4, 2026, 10:36 AM UTC
- Filtered views of those pages1
Derived from observations · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- URLs carrying a query string, not listed individually
- First observed
- Sep 4, 2026, 10:36 AM UTC
Infrastructure
- Hosts observedpellysfishmarketandcafe.com, www.pellysfishmarketandcafe.com, order.pellysfishmarketandcafe.com, pay.pellysfishmarketandcafe.com
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- First observed
- Sep 4, 2026, 10:36 AM UTC
- HTTP versionHTTP/1.1
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- https://pellysfishmarketandcafe.com/
- First observed
- Sep 4, 2026, 10:36 AM UTC
- Homepage status200
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- https://pellysfishmarketandcafe.com/
- First observed
- Sep 4, 2026, 10:36 AM UTC
- TLS versionTLSv1.3
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- TLS handshake with SNI pellysfishmarketandcafe.com
- First observed
- Sep 4, 2026, 10:36 AM UTC
- ALPNhttp/1.1
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- TLS handshake with SNI pellysfishmarketandcafe.com
- First observed
- Sep 4, 2026, 10:36 AM UTC
- Announcing networkAS13335 CLOUDFLARENET - Cloudflare, Inc., US
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- DNS A/AAAA → BGP prefix origin → RIR registry
- First observed
- Sep 4, 2026, 10:36 AM UTC
- Announcing networkAS14618 AMAZON-AES - Amazon.com, Inc., US
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- DNS A/AAAA → BGP prefix origin → RIR registry
- First observed
- Sep 4, 2026, 10:36 AM UTC
- Announcing networkAS16509 AMAZON-02 - Amazon.com, Inc., US
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- DNS A/AAAA → BGP prefix origin → RIR registry
- First observed
- Sep 4, 2026, 10:36 AM UTC
- RegistrarGoDaddy.com, LLC
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- RDAP
- First observed
- Sep 4, 2026, 10:36 AM UTC
- Domain first registered2017-07-25
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- RDAP
- First observed
- Sep 4, 2026, 10:36 AM UTC
- A at pellysfishmarketandcafe.com52.52.25.25
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- DNS
- First observed
- Sep 4, 2026, 10:36 AM UTC
- CNAME at order.pellysfishmarketandcafe.comsites.toasttab.com.
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- DNS
- First observed
- Sep 4, 2026, 10:36 AM UTC
- CNAME at pay.pellysfishmarketandcafe.compaylinks.commerce.godaddy.com.
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- DNS
- First observed
- Sep 4, 2026, 10:36 AM UTC
- NS at pellysfishmarketandcafe.comns09.domaincontrol.com. • ns10.domaincontrol.com.
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- DNS
- First observed
- Sep 4, 2026, 10:36 AM UTC
- SOA at pellysfishmarketandcafe.comns09.domaincontrol.com. dns.jomax.net. 2026041705 28800 7200 604800 600
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- DNS
- First observed
- Sep 4, 2026, 10:36 AM UTC
- Authorised to send mail as this domainsecureserver.net
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- pellysfishmarketandcafe.com → declared as spf_include → observed in static_parse
- First observed
- Sep 4, 2026, 10:36 AM UTC
- Mail exchangers0 pellysfishmarketandcafe-com.mail.protection.outlook.com.
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- DNS MX
- SPF recordv=spf1 include:secureserver.net -all
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- DNS TXT
- MX at pellysfishmarketandcafe.com0 pellysfishmarketandcafe-com.mail.protection.outlook.com.
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- DNS
- First observed
- Sep 4, 2026, 10:36 AM UTC
- TXT at pellysfishmarketandcafe.comNETORGFT15892118.onmicrosoft.com • v=spf1 include:secureserver.net -all
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- DNS
- First observed
- Sep 4, 2026, 10:36 AM UTC
Security
- Strict-Transport-Securitymax-age=31536000; includeSubDomains; preload
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- HTTP response header from www.pellysfishmarketandcafe.com
- First observed
- Sep 4, 2026, 10:36 AM UTC
- X-Content-Type-Optionsnosniff
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- HTTP response header from www.pellysfishmarketandcafe.com
- First observed
- Sep 4, 2026, 10:36 AM UTC
- Referrer-Policyno-referrer-when-downgrade, strict-origin
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- HTTP response header from www.pellysfishmarketandcafe.com
- First observed
- Sep 4, 2026, 10:36 AM UTC
- Permissions-Policygeolocation=(),midi=(),sync-xhr=(),microphone=(),camera=(),magnetometer=(),gyroscope=(),fullscreen=(self),payment=()
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- HTTP response header from www.pellysfishmarketandcafe.com
- First observed
- Sep 4, 2026, 10:36 AM UTC
- X-Frame-OptionsDENY
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- HTTP response header from www.pellysfishmarketandcafe.com
- First observed
- Sep 4, 2026, 10:36 AM UTC
- Content-Security-Policydirectives: frame-ancestors, upgrade-insecure-requests
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- HTTP response header from www.pellysfishmarketandcafe.com
- First observed
- Sep 4, 2026, 10:36 AM UTC
- Certificate issuerLet's Encrypt
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- TLS handshake with SNI pellysfishmarketandcafe.com
- First observed
- Sep 4, 2026, 10:36 AM UTC
- Certificate expires2026-10-16
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- TLS handshake with SNI pellysfishmarketandcafe.com
- First observed
- Sep 4, 2026, 10:36 AM UTC
- DNSSEC signedNo
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- RDAP
- First observed
- Sep 4, 2026, 10:36 AM UTC
Technology
- Bootstrapname: Bootstrap · @type: SoftwareApplication
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- https://pellysfishmarketandcafe.com → wappalyzer ruleset match → observed in static_fetch
- First observed
- Sep 4, 2026, 10:36 AM UTC
- FancyBoxname: FancyBox · @type: SoftwareApplication
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- https://pellysfishmarketandcafe.com → wappalyzer ruleset match → observed in static_fetch
- First observed
- Sep 4, 2026, 10:36 AM UTC
- Google Analyticsname: Google Analytics · @type: SoftwareApplication
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- https://pellysfishmarketandcafe.com → wappalyzer ruleset match → observed in static_fetch
- First observed
- Sep 4, 2026, 10:36 AM UTC
- HSTSname: HSTS · @type: SoftwareApplication
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- https://pellysfishmarketandcafe.com → wappalyzer ruleset match → observed in static_fetch
- First observed
- Sep 4, 2026, 10:36 AM UTC
- OWL Carouselname: OWL Carousel · @type: SoftwareApplication
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- https://pellysfishmarketandcafe.com → wappalyzer ruleset match → observed in static_fetch
- First observed
- Sep 4, 2026, 10:36 AM UTC
- SpotHoppername: SpotHopper · @type: SoftwareApplication
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- https://pellysfishmarketandcafe.com → wappalyzer ruleset match → observed in static_fetch
- First observed
- Sep 4, 2026, 10:36 AM UTC
- UIKitname: UIKit · @type: SoftwareApplication
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- https://pellysfishmarketandcafe.com → wappalyzer ruleset match → observed in static_fetch
- First observed
- Sep 4, 2026, 10:36 AM UTC
- jQueryname: jQuery · @type: SoftwareApplication
Directly observed · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- https://pellysfishmarketandcafe.com → wappalyzer ruleset match → observed in static_fetch
- First observed
- Sep 4, 2026, 10:36 AM UTC
- Loads script fromstatic.spotapps.co
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- https://pellysfishmarketandcafe.com → declared as script_src → observed in static_parse
- First observed
- Sep 4, 2026, 10:36 AM UTC
- Loads stylesheet fromstatic.spotapps.co
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- https://pellysfishmarketandcafe.com → declared as stylesheet → observed in static_parse
- First observed
- Sep 4, 2026, 10:36 AM UTC
- Referenced in inline scripttmt.spotapps.co
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- https://pellysfishmarketandcafe.com → declared as inline_script → observed in static_parse
- First observed
- Sep 4, 2026, 10:36 AM UTC
- Referenced in inline scriptunpkg.com
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- https://pellysfishmarketandcafe.com → declared as inline_script → observed in static_parse
- First observed
- Sep 4, 2026, 10:36 AM UTC
- Loads script fromwcache-plugins.spotapps.co
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- https://pellysfishmarketandcafe.com → declared as script_src → observed in static_parse
- First observed
- Sep 4, 2026, 10:36 AM UTC
- Loads stylesheet fromwcache-plugins.spotapps.co
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- https://pellysfishmarketandcafe.com → declared as stylesheet → observed in static_parse
- First observed
- Sep 4, 2026, 10:36 AM UTC
- Referenced in inline scriptwww.doordash.com
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- https://pellysfishmarketandcafe.com → declared as inline_script → observed in static_parse
- First observed
- Sep 4, 2026, 10:36 AM UTC
- Referenced in inline scriptwww.google.com
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- https://pellysfishmarketandcafe.com → declared as inline_script → observed in static_parse
- First observed
- Sep 4, 2026, 10:36 AM UTC
- Loads script fromwww.googletagmanager.com
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- https://pellysfishmarketandcafe.com → declared as script_src → observed in static_parse
- First observed
- Sep 4, 2026, 10:36 AM UTC
- Referenced in inline scriptwww.spothopperapp.com
Published by the company · confirmed Sep 4, 2026, 10:36 AM UTC
- Observed via
- https://pellysfishmarketandcafe.com → declared as inline_script → observed in static_parse
- First observed
- Sep 4, 2026, 10:36 AM UTC